EXOSC1 (NM_016046) Human Recombinant Protein
CAT#: TP306007
Recombinant protein of human exosome component 1 (EXOSC1)
View other "EXOSC1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206007 protein sequence
Red=Cloning site Green=Tags(s) MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAI VTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQS NYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057130 |
Locus ID | 51013 |
UniProt ID | Q9Y3B2 |
Cytogenetics | 10q24.1 |
Refseq Size | 1150 |
Refseq ORF | 585 |
Synonyms | CGI-108; CSL4; Csl4p; p13; PCH1F; SKI4; Ski4p |
Summary | This gene encodes a core component of the exosome. The mammalian exosome is required for rapid degradation of AU rich element-containing RNAs but not for poly(A) shortening. The association of this protein with the exosome is mediated by protein-protein interactions with ribosomal RNA-processing protein 42 and ribosomal RNA-processing protein 46. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414227 | EXOSC1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414227 | Transient overexpression lysate of exosome component 1 (EXOSC1) |
USD 396.00 |
|
PH306007 | EXOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_057130) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review