Neuropeptide Y (NPY) (NM_000905) Human Recombinant Protein
CAT#: TP306056
Purified recombinant protein of Human neuropeptide Y (NPY), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Other products for "NPY"
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206056 protein sequence
Red=Cloning site Green=Tags(s) MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP ETLISDLLMRESTENVPRTRLEDPAMW myc-FLAG tag |
| Tag | Myc-DDK |
| Predicted MW | 10.9 kDa |
| Concentration | >50 ug/mL as determined by microplate Bradford method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000896 |
| Locus ID | 4852 |
| UniProt ID | P01303, A4D158 |
| Cytogenetics | 7p15.3 |
| Refseq Size | 576 |
| Refseq ORF | 291 |
| Synonyms | PYY4 |
| Summary | This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China