Neuropeptide Y (NPY) (NM_000905) Human Recombinant Protein

CAT#: TP306056

Purified recombinant protein of Human neuropeptide Y (NPY), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein NPY was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206056 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
  ETLISDLLMRESTENVPRTRLEDPAMW
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 10.9 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000896
• Locus ID: 4852
• UniProt ID: P01303, A4D158
• Cytogenetics: 7p15.3
• Refseq Size: 576
• Refseq ORF: 291
• Synonyms: PYY4
• Summary: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway