SCCPDH (NM_016002) Human Recombinant Protein

CAT#: TP306072

Recombinant protein of human saccharopine dehydrogenase (putative) (SCCPDH)

Product Images

Coomassie blue staining of purified SCCPDH protein (Cat# TP306072). The protein was produced from HEK293T cells transfected with SCCPDH cDNA clone (Cat# RC206072) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206072 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATEQRPFHLVVFGASGFTGQFVTEEVAREQVDPERSSRLPWAVAGRSREKLQRVLEKAALKLGRPTLSS
  EVGIIICDIANPASLDEMAKQATVVLNCVGPYRFYGEPVIKACIENGASCIDISGEPQFLELMQLKYHEK
  AADKGVYIIGSSGFDSIPADLGVIYTRNKMNGTLTAVESFLTIHSGHEGLSIHDGTWKSAIYGFGDQSNL
  RKLRNVSNLKPVPLIGPKLKRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTV
  GGITSVIKLMFAGLFFLFFVRFGIGRQLLIKFPWFFSFGYFSKQGPTQKQIDAASFTLTFFGQGYSRGTG
  TDKNKPNIKICTQVKGPEAGYVATPIAMVQAAMTLLSDASHLPKAGGVFTPGAAFSKTKLIDRLNKHGIE
  FSVISSSEV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057086
• Locus ID: 51097
• UniProt ID: Q8NBX0, A0A384NPM7
• Cytogenetics: 1q44
• Refseq Size: 2482
• Refseq ORF: 1287
• Synonyms: CGI-49; NET11
• Protein Families: Transmembrane