ELMOD1 (NM_018712) Human Recombinant Protein

CAT#: TP306126

Recombinant protein of human ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 1

Product Images

Coomassie blue staining of purified ELMOD1 protein (Cat# TP306126). The protein was produced from HEK293T cells transfected with ELMOD1 cDNA clone (Cat# RC206126) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206126 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSV
  SVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK
  LWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDI
  TKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYL
  MHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061182
• Locus ID: 55531
• UniProt ID: Q8N336
• Cytogenetics: 11q22.3
• Refseq Size: 3006
• Refseq ORF: 1002
• Summary: Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.[UniProtKB/Swiss-Prot Function]