MSL3L1 (MSL3) (NM_078629) Human Recombinant Protein
CAT#: TP306888
Recombinant protein of human male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1
View other "MSL3" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206888 protein sequence
Red=Cloning site Green=Tags(s) MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF LAEYHDDFFPESAYVAACEAHYSTKNPRAIY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_523353 |
Locus ID | 10943 |
UniProt ID | Q8N5Y2 |
Cytogenetics | Xp22.2 |
Refseq Size | 2359 |
Refseq ORF | 1563 |
Synonyms | MRSXBA; MRXS36; MRXSBA; MSL3L1 |
Summary | This gene encodes a nuclear protein that is similar to the product of the Drosophila male-specific lethal-3 gene. The Drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus, the human protein is thought to play a similar function in chromatin remodeling and transcriptional regulation, and it has been found as part of a complex that is responsible for histone H4 lysine-16 acetylation. This gene can undergo X inactivation. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 7 and 8. [provided by RefSeq, Jul 2010] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409197 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC409198 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429934 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409197 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 4 |
USD 605.00 |
|
LY409198 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1 |
USD 396.00 |
|
LY429934 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1 |
USD 396.00 |
|
PH306888 | MSL3 MS Standard C13 and N15-labeled recombinant protein (NP_523353) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review