Galanin (GAL) (NM_015973) Human Recombinant Protein

CAT#: TP307053

Recombinant protein of human galanin prepropeptide (GAL)

Product Images

Coomassie blue staining of purified GAL protein (Cat# TP307053). The protein was produced from HEK293T cells transfected with GAL cDNA clone (Cat# RC207053) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207053 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED
  DMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057057
• Locus ID: 51083
• UniProt ID: P22466
• Cytogenetics: 11q13.2
• Refseq Size: 778
• Refseq ORF: 369
• Synonyms: ETL8; GAL-GMAP; GALN; GLNN; GMAP
• Summary: This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system. [provided by RefSeq, Jul 2015]
• Protein Families: Secreted Protein, Transmembrane