KCNIP4 (NM_001035004) Human Recombinant Protein

CAT#: TP307464

Recombinant protein of human Kv channel interacting protein 4 (KCNIP4), transcript variant 6

Product Images

Coomassie blue staining of purified KCNIP4 protein (Cat# TP307464). The protein was produced from HEK293T cells transfected with KCNIP4 cDNA clone (Cat# RC207464) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207464 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP
  EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV
  SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE
  TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001030176
• Locus ID: 80333
• UniProt ID: Q6PIL6, A8K4N3
• Cytogenetics: 4p15.31-p15.2
• Refseq Size: 2345
• Refseq ORF: 753
• Synonyms: CALP; KCHIP4
• Summary: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other