beta 2 Microglobulin (B2M) (NM_004048) Human Recombinant Protein
CAT#: TP307587
Recombinant protein of human beta-2-microglobulin (B2M)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207587 representing NM_004048
Red=Cloning site Green=Tags(s) MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.7 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004039 |
| Locus ID | 567 |
| UniProt ID | P61769 |
| Cytogenetics | 15q21.1 |
| Refseq Size | 987 |
| Refseq ORF | 357 |
| Synonyms | IMD43 |
| Summary | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401311 | B2M HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401311 | Transient overexpression lysate of beta-2-microglobulin (B2M) |
USD 436.00 |
|
| PH307587 | B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039) |
USD 2,055.00 |
|
| TP710178 | Recombinant protein of human beta-2-microglobulin (B2M), residues 21-119aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
| TP720425 | Recombinant protein of human beta-2-microglobulin (B2M) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China