beta 2 Microglobulin (B2M) (NM_004048) Human Mass Spec Standard

CAT#: PH307587

B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039)

Product Images

Coomassie blue staining of purified B2M protein (Cat# TP307587). The protein was produced from HEK293T cells transfected with B2M cDNA clone (Cat# RC207587) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207587
• Predicted MW: 13.71 kDa
• Protein Sequence:
  Sequence Link

  >RC207587 representing NM_004048
  Red=Cloning site Green=Tags(s)
  
  MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE
  HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004039
• RefSeq Size: 987
• RefSeq ORF: 357
• Synonyms: IMD43
• Locus ID: 567
• UniProt ID: P61769
• Cytogenetics: 15q21.1
• Summary: 'This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Antigen processing and presentation