MAST4 (NM_198828) Human Recombinant Protein

CAT#: TP307706

Recombinant protein of human microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2

Product Images

Coomassie blue staining of purified MAST4 protein (Cat# TP307706). The protein was produced from HEK293T cells transfected with MAST4 cDNA clone (Cat# RC207706) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207706 representing NM_198828
  Red=Cloning site Green=Tags(s)
  
  MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLG
  GTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPD
  VASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSL
  TASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_942123
• Locus ID: 375449
• UniProt ID: O15021
• Cytogenetics: 5q12.3
• Refseq Size: 1105
• Refseq ORF: 750
• Summary: This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
• Protein Families: Druggable Genome, Protein Kinase