C13orf31 (LACC1) (NM_153218) Human Recombinant Protein

CAT#: TP307834

Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 2

Product Images

Analysis of human recombinant FAMIN laccase activity. Four phenolic substrates (DMP, Guaiacol, L-DOPA and SGZ) were tested to evaluate laccase activity of the C-terminal MYC/DDK-tagged recombinant FAMIN protein (OriGene TP307834). Data are representative of three independent experiments. Figure cited from PLoS ONE, PMID: 27959965

• 

  Coomassie blue staining of purified LACC1 protein (Cat# TP307834). The protein was produced from HEK293T cells transfected with LACC1 cDNA clone (Cat# RC207834) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207834 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS
  ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG
  GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF
  NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL
  GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA
  EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG
  TQIGFISIKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme activity (PMID: 27959965)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694950
• Locus ID: 144811
• UniProt ID: Q8IV20
• Cytogenetics: 13q14.11
• Refseq Size: 4124
• Refseq ORF: 1290
• Synonyms: C13orf31; FAMIN; JUVAR
• Summary: This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein forms a complex with fatty acid synthase on peroxisomes and is thought to be modulated by peroxisome proliferator-activated receptor signaling events. Naturally occurring mutations in this gene are associated with inflammatory bowel disease, Behcet's disease, leprosy, ulcerative colitis, early-onset Crohn's disease, and systemic juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017]