MARCHF3 (NM_178450) Human Recombinant Protein

CAT#: TP307968

Recombinant protein of human membrane-associated ring finger (C3HC4) 3 (MARCH3)

Product Images

Coomassie blue staining of purified MARCH3 protein (Cat# TP307968). The protein was produced from HEK293T cells transfected with MARCH3 cDNA clone (Cat# RC207968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207968 representing NM_178450
  Red=Cloning site Green=Tags(s)
  
  MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM
  CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH
  EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL
  YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848545
• Locus ID: 115123
• UniProt ID: Q86UD3
• Cytogenetics: 5q23.2
• Refseq Size: 1816
• Refseq ORF: 759
• Synonyms: MARCH-III; MARCH3; RNF173
• Summary: This gene encodes a member of the membrane-associated RING-CH (MARCH) family. The encoded protein is an E3 ubiquitin-protein ligase that may be involved in regulation of the endosomal transport pathway. [provided by RefSeq, Mar 2013]
• Protein Families: Druggable Genome, Transmembrane