MARCH3 (NM_178450) Human Mass Spec Standard

CAT#: PH307968

MARCH3 MS Standard C13 and N15-labeled recombinant protein (NP_848545)

Product Images

Coomassie blue staining of purified MARCH3 protein (Cat# TP307968). The protein was produced from HEK293T cells transfected with MARCH3 cDNA clone (Cat# RC207968) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207968
• Predicted MW: 28.3 kDa
• Protein Sequence:
  Sequence Link

  >RC207968 representing NM_178450
  Red=Cloning site Green=Tags(s)
  
  MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLATQSPFNDRPM
  CRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFAVERKPRPLVEWLRNPGPQH
  EKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALTVALFTIYLFWTLVSFRYHCRL
  YNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848545
• RefSeq Size: 1816
• RefSeq ORF: 759
• Synonyms: MARCH-III; RNF173
• Locus ID: 115123
• UniProt ID: Q86UD3
• Cytogenetics: 5q23.2
• Summary: This gene encodes a member of the membrane-associated RING-CH (MARCH) family. The encoded protein is an E3 ubiquitin-protein ligase that may be involved in regulation of the endosomal transport pathway. [provided by RefSeq, Mar 2013]
• Protein Families: Druggable Genome, Transmembrane