Pirh2 (RCHY1) (NM_015436) Human Recombinant Protein

CAT#: TP307970

Recombinant protein of human ring finger and CHY zinc finger domain containing 1 (RCHY1), transcript variant 1

Product Images

Coomassie blue staining of purified RCHY1 protein (Cat# TP307970). The protein was produced from HEK293T cells transfected with RCHY1 cDNA clone (Cat# RC207970) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207970 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH
  AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV
  SQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP
  SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056251
• Locus ID: 25898
• UniProt ID: Q96PM5
• Cytogenetics: 4q21.1
• Refseq Size: 4447
• Refseq ORF: 783
• Synonyms: ARNIP; CHIMP; PIRH2; PRO1996; RNF199; ZCHY; ZNF363
• Summary: The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2013]
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: p53 signaling pathway, Ubiquitin mediated proteolysis