Pirh2 (RCHY1) (NM_015436) Human Mass Spec Standard

CAT#: PH307970

RCHY1 MS Standard C13 and N15-labeled recombinant protein (NP_056251)

Product Images

Coomassie blue staining of purified RCHY1 protein (Cat# TP307970). The protein was produced from HEK293T cells transfected with RCHY1 cDNA clone (Cat# RC207970) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207970
• Predicted MW: 30.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207970 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH
  AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV
  SQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP
  SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056251
• RefSeq Size: 4447
• RefSeq ORF: 783
• Synonyms: ARNIP; CHIMP; PIRH2; PRO1996; RNF199; ZCHY; ZNF363
• Locus ID: 25898
• UniProt ID: Q96PM5
• Cytogenetics: 4q21.1
• Summary: The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2013]
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: p53 signaling pathway, Ubiquitin mediated proteolysis