CD3E (NM_000733) Human Recombinant Protein
CAT#: TP308276
Recombinant protein of human CD3e molecule, epsilon (CD3-TCR complex) (CD3E)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208276 protein sequence
Red=Cloning site Green=Tags(s) MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDE DDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICI TGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000724 |
Locus ID | 916 |
UniProt ID | P07766 |
Cytogenetics | 11q23.3 |
Refseq Size | 1534 |
Refseq ORF | 621 |
Synonyms | IMD18; T3E; TCRE |
Summary | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400242 | CD3E HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400242 | Transient overexpression lysate of CD3e molecule, epsilon (CD3-TCR complex) (CD3E) |
USD 325.00 |
|
PH308276 | CD3E MS Standard C13 and N15-labeled recombinant protein (NP_000724) |
USD 2,055.00 |
|
TP700034 | Recombinant protein of human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), expressed in human cells |
USD 748.00 |
|
TP720690 | Purified recombinant protein of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E) |
USD 300.00 |
|
TP790061 | Purified recombinant protein of CD3-epsilon/delta heterodimers, with C-terminal His tag, secretory expressed in 293E cells, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review