CD3E (NM_000733) Human Recombinant Protein
CAT#: TP720690
Purified recombinant protein of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH
|
Tag | C-His |
Predicted MW | 12.79 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000724 |
Locus ID | 916 |
UniProt ID | P07766 |
Cytogenetics | 11q23.3 |
Refseq Size | 1534 |
Refseq ORF | 621 |
Synonyms | IMD18; T3E; TCRE |
Summary | 'The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400242 | CD3E HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400242 | Transient overexpression lysate of CD3e molecule, epsilon (CD3-TCR complex) (CD3E) |
USD 325.00 |
|
PH308276 | CD3E MS Standard C13 and N15-labeled recombinant protein (NP_000724) |
USD 2,055.00 |
|
TP308276 | Recombinant protein of human CD3e molecule, epsilon (CD3-TCR complex) (CD3E) |
USD 439.00 |
|
TP700034 | Recombinant protein of human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), expressed in human cells |
USD 748.00 |
|
TP790061 | Purified recombinant protein of CD3-epsilon/delta heterodimers, with C-terminal His tag, secretory expressed in 293E cells, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review