CELF3 (NM_007185) Human Recombinant Protein
CAT#: TP308465
Recombinant protein of human trinucleotide repeat containing 4 (TNRC4)
View other "CELF3" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208465 protein sequence
Red=Cloning site Green=Tags(s) MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV KFQTHAEAKAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPITLQFGAYSAYTQA LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVN GYSQVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVA QQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSK CFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009116 |
Locus ID | 11189 |
UniProt ID | Q5SZQ8 |
Cytogenetics | 1q21.3 |
Refseq Size | 5615 |
Refseq ORF | 1035 |
Synonyms | BRUNOL1; CAGH4; ERDA4; ETR-1; TNRC4 |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416136 | CELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC433039 | CELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416136 | Transient overexpression lysate of trinucleotide repeat containing 4 (TNRC4) |
USD 396.00 |
|
LY433039 | Transient overexpression lysate of CUGBP, Elav-like family member 3 (CELF3), transcript variant 3 |
USD 396.00 |
|
PH308465 | CELF3 MS Standard C13 and N15-labeled recombinant protein (NP_009116) |
USD 2,055.00 |
|
TP330039 | Purified recombinant protein of Homo sapiens CUGBP, Elav-like family member 3 (CELF3), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review