CELF3 (NM_007185) Human Mass Spec Standard

CAT#: PH308465

CELF3 MS Standard C13 and N15-labeled recombinant protein (NP_009116)

Product Images

Coomassie blue staining of purified CELF3 protein (Cat# TP308465). The protein was produced from HEK293T cells transfected with CELF3 cDNA clone (Cat# RC208465) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208465
• Predicted MW: 50.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208465 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE
  QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV
  KFQTHAEAKAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPITLQFGAYSAYTQA
  LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVN
  GYSQVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVA
  QQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSK
  CFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009116
• RefSeq Size: 5615
• RefSeq ORF: 1035
• Synonyms: BRUNOL1; CAGH4; ERDA4; ETR-1; TNRC4
• Locus ID: 11189
• UniProt ID: Q5SZQ8
• Cytogenetics: 1q21.3
• Summary: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010]
• Protein Families: Transcription Factors