CABS1 (NM_033122) Human Recombinant Protein

CAT#: TP308496

Recombinant protein of human chromosome 4 open reading frame 35 (C4orf35)

Product Images

Coomassie blue staining of purified CABS1 protein (Cat# TP308496). The protein was produced from HEK293T cells transfected with CABS1 cDNA clone (Cat# RC208496) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208496 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEDGLPKIYSHPPTESSKTPTAATIFFGADNAIPKSETTITSEGDHVTSVNEYMLESDFSTTTDNKLTA
  KKEKLKSEDDMGTDFIKSTTHLQKEITSLTGTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIA
  KEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVPADEAVQVTDS
  IIPEAEIPPAPEESFTTIPDITALEEEKITEIDLSVLEDDTSAVATLTDSDEKFITVFELTTSAEKDKDK
  REDTLLTDEETTEGASIGMERDTANEAETHSVLLTAVESRYDFVVPASIATNLVEESSTEEDLSETDNTE
  TVPKITEPFSGTTSVLDTPDYKEDTSTTETDIFELLKEEPDEFMI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_149113
• Locus ID: 85438
• UniProt ID: Q96KC9
• Cytogenetics: 4q13.3
• Refseq Size: 1558
• Refseq ORF: 1185
• Synonyms: C4orf35; CLPH; NYD-SP26
• Summary: Calcium-binding protein (By similarity). Essential for maintaining the structural integrity of the sperm flagella (By similarity).[UniProtKB/Swiss-Prot Function]