LRATD1 (NM_145175) Human Recombinant Protein

CAT#: TP308623

Recombinant protein of human family with sequence similarity 84, member A (FAM84A)

Product Images

Coomassie blue staining of purified LRATD1 protein (Cat# TP308623). The protein was produced from HEK293T cells transfected with LRATD1 cDNA clone (Cat# RC208623) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208623 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR
  HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP
  APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT
  NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV
  LQELADLVDDKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Immunoprecipitation (PMID: 27325759)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_660158
• Locus ID: 151354
• UniProt ID: Q96KN4
• Cytogenetics: 2p24.3
• Refseq Size: 6366
• Refseq ORF: 876
• Synonyms: FAM84A; NSE1; PP11517
• Summary: May play a role in cell morphology and motility.[UniProtKB/Swiss-Prot Function]