DDX1 (NM_004939) Human Recombinant Protein

CAT#: TP308769

Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 (DDX1)

Product Images

DDX1 interacts with Nullbasic in vitro, as measured by the Octet Red system. Biotinylated recombinant Nullbasic-FLAG-V5-6-His was bound to a streptavidin biosensor and applied to solutions containing 3.3, 10, 30 or 90 nM of human recombinant Myc-DDK-tagged DDX1 (OriGene TP308769). BSA served as a control. Figure cited from Retrovirology, PMID: 25496916

• 

  Coomassie blue staining of purified DDX1 protein (Cat# TP308769). The protein was produced from HEK293T cells transfected with DDX1 cDNA clone (Cat# RC208769) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208769 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKD
  QQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCH
  DQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGK
  DLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQT
  KFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRL
  DDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
  KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIK
  ILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER
  FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHV
  CSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGS
  YKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 82.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Biolayer interferometry (BLI) assay (PMID: 25496916)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004930
• Locus ID: 1653
• UniProt ID: Q92499, A3RJH1
• Cytogenetics: 2p24.3
• Refseq Size: 2755
• Refseq ORF: 2220
• Synonyms: DBP-RB; UKVH5d
• Summary: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome