SKAR (POLDIP3) (NM_178136) Human Recombinant Protein

CAT#: TP308957

Purified recombinant protein of Human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein POLDIP3 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208957 representing NM_178136
  Red=Cloning site Green=Tags(s)
  
  MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG
  VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT
  PALKLTKTIQNLYDLDEDDDGIASVPTKQMKFAASGGFLHHMAGLSSSKLSMSKALPLTKVVQNDAYTAP
  ALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRA
  RLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKESELPR
  RVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIKL
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 42.7 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH7.3, 100 mM glycine, 10% glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_835237
• Locus ID: 84271
• UniProt ID: Q9BY77, Q9BY77-2
• Cytogenetics: 22q13.2
• Refseq Size: 3348
• Refseq ORF: 1176
• Synonyms: PDIP3; PDIP46; SKAR
• Summary: This gene encodes an RRM (RNA recognition motif)-containing protein that participates in the regulation of translation by recruiting ribosomal protein S6 kinase beta-1 to mRNAs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]