CSDC2 (NM_014460) Human Recombinant Protein
CAT#: TP308989
Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208989 protein sequence
Red=Cloning site Green=Tags(s) MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH TPHETWSGQVVGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055275 |
Locus ID | 27254 |
UniProt ID | Q9Y534 |
Cytogenetics | 22q13.2 |
Refseq Size | 2545 |
Refseq ORF | 459 |
Synonyms | dJ347H13.2; PIPPIN |
Summary | RNA-binding factor which binds specifically to the very 3' UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415263 | CSDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415263 | Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) |
USD 325.00 |
|
PH308989 | CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275) |
USD 2,055.00 |
|
TP710146 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review