LAP3 (NM_015907) Human Recombinant Protein

CAT#: TP309052

Recombinant protein of human leucine aminopeptidase 3 (LAP3)


  View other "LAP3" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
    • 100 ul

USD 475.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "LAP3"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC209052 protein sequence
Red=Cloning site Green=Tags(s)

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET
LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV
EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM
TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV
GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV
RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD
EVPYLRKGMTGRPTRTLIEFLLRFSQDNA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity LAP3 activity verified in a biochemical assay: Leucine aminopeptidase 3 (LAP3, TP309052) activity was measured in a fluorescent biochemical assay. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides and is most active on leucine. LAP3 activity was measured in a 100 µl reaction mixture containing 1 mM L-leucine 7-amido-4-methyl coumarin (Leu-AMC), 50 mM Tris, pH 8.0, 4 mM MgCl2, and 1 mM MnCl2. Cleavage of leucine from the AMC moiety results in a strong increase in fluorescence intensity. Fluorescence was measured over time with an excitation wavelength of 380 nm and an emission wavelength of 460 nm. The activity of the enzyme in this system remained constant over six hours.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_056991
Locus ID 51056
UniProt ID P28838
Cytogenetics 4p15.32
Refseq Size 2100
Refseq ORF 1557
Synonyms HEL-S-106; LAP; LAPEP; PEPS
Summary Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Protease
Protein Pathways Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.