LAP3 Rabbit Polyclonal Antibody

CAT#: TA345102

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

Product Images

WB Suggested Anti-LAP3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: LAP3; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: LAP3; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: LAP3; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; LAP3 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: leucine aminopeptidase 3
• Database Link:
  NP_056991
  Entrez Gene 51056 Human
  UniProt ID P28838
• Background: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
• Synonyms: HEL-S-106; LAP; LAPEP; PEPS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways