ELK4 (NM_021795) Human Recombinant Protein
CAT#: TP309572
Recombinant protein of human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209572 protein sequence
Red=Cloning site Green=Tags(s) MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN IIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRND YIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISI GPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDT DIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068567 |
Locus ID | 2005 |
UniProt ID | P28324, A0A024R997, Q8IXL1 |
Cytogenetics | 1q32.1 |
Refseq Size | 3077 |
Refseq ORF | 1215 |
Synonyms | SAP1 |
Summary | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411912 | ELK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419619 | ELK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY411912 | Transient overexpression lysate of ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant b |
USD 396.00 |
|
LY419619 | Transient overexpression lysate of ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant a |
USD 605.00 |
|
PH309572 | ELK4 MS Standard C13 and N15-labeled recombinant protein (NP_068567) |
USD 2,055.00 |
|
TP760364 | Purified recombinant protein of Human ELK4, ETS-domain protein (SRF accessory protein 1) (ELK4), transcript variant a, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review