Grainyhead like protein 1 homolog (GRHL1) (NM_014552) Human Recombinant Protein

CAT#: TP309683

Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1

Product Images

Coomassie blue staining of purified GRHL1 protein (Cat# TP309683). The protein was produced from HEK293T cells transfected with GRHL1 cDNA clone (Cat# RC209683) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209683 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDSAAALGLLYDYYKV
  PRERRSSTAKPEVEHPEPDHSKRNSIPIVTEQPLISAGENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTA
  PDTTVTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPD
  STFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFY
  PITLKEVSSSEGIHHPISKVRSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISN
  VEEIAYNAISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQIDTYSYNNRSNKPVHRAYCQIKVF
  CDKGAERKIRDEERKQSKRKVSDVKVPLLPSHKRMDITVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLP
  IASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAI
  SDKYDVPHDKIGKIFKKCKKGILVNMDDNIVKHYSNEDTFQLQIEEAGGSYKLTLTEI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 69.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055367
• Locus ID: 29841
• UniProt ID: Q9NZI5
• Cytogenetics: 2p25.1
• Refseq Size: 3610
• Refseq ORF: 1854
• Synonyms: grainyhead-like 1 (Drosophila); LBP-32; LBP32; LBP protein 32; leader-binding protein 32; mammalian grainyhead; MGR; TFCP2L2; transcription factor CP2-like 2
• Summary: This gene encodes a member of the grainyhead family of transcription factors. The encoded protein can exist as a homodimer or can form heterodimers with sister-of-mammalian grainyhead or brother-of-mammalian grainyhead. This protein functions as a transcription factor during development. [provided by RefSeq, Jun 2009]
• Protein Families: Transcription Factors, Transmembrane