Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein

CAT#: TP310143

Recombinant protein of human mannose-binding lectin (protein C) 2, soluble (opsonic defect) (MBL2)


  View other "MBL2" proteins (4)

USD 439.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


MBL2 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
    • 100 ul

USD 379.00

Other products for "MBL2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC210143 protein sequence
Red=Cloning site Green=Tags(s)

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQ
GPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFL
TNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNE
GEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000233
Locus ID 4153
UniProt ID P11226
Cytogenetics 10q21.1
Refseq Size 3569
Refseq ORF 744
Synonyms COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Summary This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jun 2020]
Protein Families Druggable Genome
Protein Pathways Complement and coagulation cascades

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.