Mannan Binding Lectin (MBL2) (NM_000242) Human Recombinant Protein
CAT#: TP720671
Purified recombinant protein of Human mannose-binding lectin (protein C) 2, soluble (MBL2)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPIVDHHHHHH
|
Tag | C-His |
Predicted MW | 25.06 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000233 |
Locus ID | 4153 |
UniProt ID | P11226 |
Cytogenetics | 10q21.1 |
Refseq Size | 3569 |
Refseq ORF | 744 |
Synonyms | COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD |
Summary | 'This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jun 2020]' |
Protein Families | Druggable Genome |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424849 | MBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424849 | Transient overexpression lysate of mannose-binding lectin (protein C) 2, soluble (opsonic defect) (MBL2) |
USD 325.00 |
|
PH310143 | MBL2 MS Standard C13 and N15-labeled recombinant protein (NP_000233) |
USD 2,055.00 |
|
TP310143 | Recombinant protein of human mannose-binding lectin (protein C) 2, soluble (opsonic defect) (MBL2) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review