ANKRD2 (NM_020349) Human Recombinant Protein

CAT#: TP310468

Recombinant protein of human ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1

Product Images

Coomassie blue staining of purified ANKRD2 protein (Cat# TP310468). The protein was produced from HEK293T cells transfected with ANKRD2 cDNA clone (Cat# RC210468) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210468 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL
  LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP
  EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ
  DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG
  DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG
  RETPQPVPAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065082
• Locus ID: 26287
• UniProt ID: Q9GZV1
• Cytogenetics: 10q24.2
• Refseq Size: 1520
• Refseq ORF: 1080
• Synonyms: ARPP
• Summary: This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]