ANKRD2 (NM_020349) Human Recombinant Protein
CAT#: TP310468
Recombinant protein of human ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210468 protein sequence
Red=Cloning site Green=Tags(s) MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG RETPQPVPAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065082 |
Locus ID | 26287 |
UniProt ID | Q9GZV1 |
Cytogenetics | 10q24.2 |
Refseq Size | 1520 |
Refseq ORF | 1080 |
Synonyms | ARPP |
Summary | This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412545 | ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427086 | ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412545 | Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1 |
USD 396.00 |
|
LY427086 | Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2 |
USD 396.00 |
|
PH310468 | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_065082) |
USD 2,055.00 |
|
PH325475 | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_001123453) |
USD 2,055.00 |
|
TP325475 | Purified recombinant protein of Homo sapiens ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review