TDP43 (TARDBP) (NM_007375) Human Recombinant Protein
CAT#: TP310639
Recombinant protein of human TAR DNA binding protein (TARDBP)
View other "TARDBP" proteins (4)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210639 protein sequence
Red=Cloning site Green=Tags(s) MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | In vitro binding assay (PMID: 25738460) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_031401 |
| Locus ID | 23435 |
| UniProt ID | Q13148, Q9H256, A0A024R4E2 |
| Cytogenetics | 1p36.22 |
| Refseq Size | 4236 |
| Refseq ORF | 1242 |
| Synonyms | ALS10; TDP-43 |
| Summary | HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402137 | TARDBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402137 | Transient overexpression lysate of TAR DNA binding protein (TARDBP) |
USD 436.00 |
|
| PH310639 | TARDBP MS Standard C13 and N15-labeled recombinant protein (NP_031401) |
USD 2,055.00 |
|
| TP710010 | Recombinant protein of human TAR DNA binding protein (TARDBP), full length, with C-terminal DDK tag,expressed in sf9 cells |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China