Serum Amyloid A (SAA1) (NM_000331) Human Recombinant Protein
CAT#: TP310664
Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 1
View other "SAA1" proteins (10)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210664 protein sequence
Red=Cloning site Green=Tags(s) MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000322 |
Locus ID | 6288 |
UniProt ID | P02735, P0DJI8 |
Cytogenetics | 11p15.1 |
Refseq Size | 678 |
Refseq ORF | 366 |
Synonyms | PIG4; SAA; SAA2; TP53I4 |
Summary | This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403693 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424788 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403693 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 2 |
USD 396.00 |
|
LY424788 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 1 |
USD 396.00 |
|
PH302738 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_954630) |
USD 2,055.00 |
|
PH310664 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322) |
USD 2,055.00 |
|
TP302738 | Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 2 |
USD 823.00 |
|
TP723018 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1. |
USD 240.00 |
|
TP723019 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, with substitutions of asparagine for aspartic acid at position 60 and arginine for histidine at position 71. |
USD 240.00 |
|
TP750173 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, 19Arg-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review