Serum Amyloid A (SAA1) (NM_000331) Human Recombinant Protein
CAT#: TP723018
Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISNARENIQRFFGRGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
|
| Tag | Tag Free |
| Predicted MW | 12 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Tested by its ability to down-regulate lipid biosynthesis in aortic smooth muscle cells. The effective concentration was found to be 4 uM.* * Schreiber, BM. et al. Biochem J. 1999 Nov 15; 344 Pt 1:7-13 |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000322 |
| Locus ID | 6288 |
| UniProt ID | P0DJI8 |
| Cytogenetics | 11p15.1 |
| Refseq Size | 678 |
| Refseq ORF | 366 |
| Synonyms | PIG4; SAA; SAA2; TP53I4 |
| Summary | 'This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403693 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424788 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403693 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 2 |
USD 436.00 |
|
| LY424788 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 1 |
USD 436.00 |
|
| PH302738 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_954630) |
USD 2,055.00 |
|
| PH310664 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322) |
USD 2,055.00 |
|
| TP302738 | Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 2 |
USD 823.00 |
|
| TP310664 | Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 1 |
USD 823.00 |
|
| TP723019 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, with substitutions of asparagine for aspartic acid at position 60 and arginine for histidine at position 71. |
USD 240.00 |
|
| TP750173 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, 19Arg-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China