POU2F3 (NM_014352) Human Recombinant Protein
CAT#: TP310969
Recombinant protein of human POU class 2 homeobox 3 (POU2F3)
View other "POU2F3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210969 protein sequence
Red=Cloning site Green=Tags(s) MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPA MMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQ TGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQG DVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGR KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPP VYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF NSSGSWYRWNHSTYLH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055167 |
Locus ID | 25833 |
UniProt ID | Q9UKI9 |
Cytogenetics | 11q23.3 |
Refseq Size | 3013 |
Refseq ORF | 1308 |
Synonyms | Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a |
Summary | This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415336 | POU2F3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415336 | Transient overexpression lysate of POU class 2 homeobox 3 (POU2F3) |
USD 396.00 |
|
PH310969 | POU2F3 MS Standard C13 and N15-labeled recombinant protein (NP_055167) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review