Lymphocyte Antigen 6 Complex (LY6K) (NM_017527) Human Recombinant Protein

CAT#: TP312498

Recombinant protein of human lymphocyte antigen 6 complex, locus K (LY6K)

Product Images

Coomassie blue staining of purified LY6K protein (Cat# TP312498). The protein was produced from HEK293T cells transfected with LY6K cDNA clone (Cat# RC212498) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212498 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLQRPRQAPAGGRRAPRGGRGSPYRPDPGRGARRLRRFQKGGEGAPRADPPWAPLGTMALLALLLVVAL
  PRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVA
  KQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGESCGGLWLAIL
  LLLASIAAGLSLS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_059997
• Locus ID: 54742
• UniProt ID: Q17RY6
• Cytogenetics: 8q24.3
• Refseq Size: 1747
• Refseq ORF: 669
• Synonyms: CT97; HSJ001348; ly-6K; URLC10
• Summary: Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane