C1ORF151 (MINOS1) (NM_001032363) Human Recombinant Protein

CAT#: TP312930

Recombinant protein of human chromosome 1 open reading frame 151 (C1orf151)

Product Images

Coomassie blue staining of purified MICOS10 protein (Cat# TP312930). The protein was produced from HEK293T cells transfected with MICOS10 cDNA clone (Cat# RC212930) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212930 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHG
  KYVKEQEQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001027535
• Locus ID: 440574
• UniProt ID: Q5TGZ0
• Cytogenetics: 1p36.13
• Refseq Size: 3726
• Refseq ORF: 234
• Synonyms: C1orf151; Mic10; MINOS1; MIO10
• Summary: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane