LRRN4CL (NM_203422) Human Recombinant Protein

CAT#: TP312939

Purified recombinant protein of Homo sapiens LRRN4 C-terminal like (LRRN4CL)

Product Images

Coomassie blue staining of purified LRRN4CL protein (Cat# TP312939). The protein was produced from HEK293T cells transfected with LRRN4CL cDNA clone (Cat# RC212939) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212939 representing NM_203422
  Red=Cloning site Green=Tags(s)
  
  MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAA
  CLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAEL
  KGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPNPRTLVHAAVGVGTALALLS
  CAALVWHFCLRDRWGCPRRAAARAAGAL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_981967
• Locus ID: 221091
• UniProt ID: Q8ND94
• Cytogenetics: 11q12.3
• Refseq Size: 2429
• Refseq ORF: 714
• Protein Families: Transmembrane