DTX2 (NM_001102594) Human Recombinant Protein
CAT#: TP312997
Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212997 representing NM_001102594
Red=Cloning site Green=Tags(s) MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADP SLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGN QLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPV SGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLY RSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPV CLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLS TASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEV LRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRL IFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 67.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001096064 |
Locus ID | 113878 |
UniProt ID | Q86UW9 |
Cytogenetics | 7q11.23 |
Refseq Size | 2715 |
Refseq ORF | 1866 |
Synonyms | RNF58 |
Summary | DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 [PubMed 12670957]).[supplied by OMIM, Nov 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Notch signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412251 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420163 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420164 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420165 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426187 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426188 | DTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412251 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 |
USD 396.00 |
|
LY420163 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 |
USD 605.00 |
|
LY420164 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 |
USD 605.00 |
|
LY420165 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 4 |
USD 605.00 |
|
LY426187 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 2 |
USD 396.00 |
|
LY426188 | Transient overexpression lysate of deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 |
USD 396.00 |
|
PH303717 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943) |
USD 2,055.00 |
|
PH312997 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096064) |
USD 2,055.00 |
|
PH313418 | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_001096065) |
USD 2,055.00 |
|
TP303717 | Recombinant protein of human deltex homolog 2 (Drosophila) (DTX2), transcript variant 1 |
USD 867.00 |
|
TP313418 | Purified recombinant protein of Homo sapiens deltex homolog 2 (Drosophila) (DTX2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review