Germany
Japan
United Kingdom
China
Amino terminal enhancer of split (AES) (NM_198970) Human Recombinant Protein
CAT#: TP313043
Purified recombinant protein of Homo sapiens amino-terminal enhancer of split (AES), transcript variant 3
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213043 representing NM_198970
Red=Cloning site Green=Tags(s) MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYG LNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQLQAHQLSQLQALALP LTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.7 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_945321 |
| Locus ID | 166 |
| UniProt ID | Q08117, Q8WY48 |
| Cytogenetics | 19p13.3 |
| Refseq Size | 1684 |
| Refseq ORF | 588 |
| Synonyms | AES; AES-1; AES-2; ESP1; GRG; Grg-5; GRG5 |
| Summary | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404646 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC420115 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC430782 | AES HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LY404646 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 |
USD 325.00 |
|
| LY420115 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 2 |
USD 325.00 |
|
| LY430782 | Transient overexpression lysate of amino-terminal enhancer of split (AES), transcript variant 3 |
USD 325.00 |
|
| PH312475 | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) |
USD 2,055.00 |
|
| PH313043 | AES MS Standard C13 and N15-labeled recombinant protein (NP_945321) |
USD 2,055.00 |
|
| TP312475 | Recombinant protein of human amino-terminal enhancer of split (AES), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
