GM CSF Receptor alpha (CSF2RA) (NM_006140) Human Recombinant Protein
CAT#: TP315857
Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215857 protein sequence
Red=Cloning site Green=Tags(s) MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWAR GPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLL DTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENR YNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFL RIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006131 |
Locus ID | 1438 |
UniProt ID | P15509 |
Cytogenetics | X;Y |
Refseq Size | 1855 |
Refseq ORF | 1200 |
Synonyms | alphaGMR; CD116; CDw116; CSF2R; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR; GMR-alpha; SMDP4 |
Summary | The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403538 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406763 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416841 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429284 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430363 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431354 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431905 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403538 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4 |
USD 325.00 |
|
LY406763 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2 |
USD 325.00 |
|
LY416841 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1 |
USD 325.00 |
|
LY429284 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1 |
USD 325.00 |
|
LY430363 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2 |
USD 325.00 |
|
LY431354 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 9 |
USD 325.00 |
|
LY431905 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7 |
USD 325.00 |
|
PH301204 | CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758448) |
USD 2,055.00 |
|
PH315857 | CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_006131) |
USD 2,055.00 |
|
PH320607 | CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758450) |
USD 2,055.00 |
|
TP301204 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2 |
USD 439.00 |
|
TP320607 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4 |
USD 748.00 |
|
TP328877 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review