Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CSF2RA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CSF2RA. |
Antibodies
View as table Download
Mouse Anti-Human CD116 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CSF2RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF2RA antibody is: synthetic peptide directed towards the C-terminal region of Human CSF2RA. Synthetic peptide located within the following region: VLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIW |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CSF2RA mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Anti-CSF2RA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 23-320 amino acids of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) |
Anti-CSF2RA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 386-400 amino acids of Human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) |
Anti-CSF2RA Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 386-400 amino acids of Human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) |
CSF2RA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1). |
| Modifications | Unmodified |
CSF2RA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-320 of human CSF2RA (NP_758448.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
CSF2RA mouse monoclonal antibody,clone OTI2B2
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
CSF2RA mouse monoclonal antibody,clone OTI2D6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
CSF2RA mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
CSF2RA mouse monoclonal antibody,clone OTI3E6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CSF2RA mouse monoclonal antibody,clone OTI3E6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
CSF2RA mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
CSF2RA mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- CSF2RA