ISM1 (NM_080826) Human Recombinant Protein

CAT#: TP322172

Recombinant protein of human isthmin 1 homolog (zebrafish) (ISM1)

Product Images

Coomassie blue staining of purified ISM1 protein (Cat# TP322172). The protein was produced from HEK293T cells transfected with ISM1 cDNA clone (Cat# RC222172) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC222172
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPR
  EHLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSE
  ADKDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFE
  TKDQPEYDSTDGEGDWSLWSVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVS
  LLAGSEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKD
  FRWKDASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAEL
  HYKVDVLPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC222172 also available, TP322172M
• Tag: C-Myc/DDK
• Predicted MW: 51.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_543016
• Locus ID: 140862
• UniProt ID: B1AKI9
• Cytogenetics: 20p12.1
• Refseq Size: 2610
• Refseq ORF: 1392
• Synonyms: bA149I18.1; C20orf82; dJ1077I2.1; ISM; Isthmin
• Summary: Acts as an angiogenesis inhibitor.[UniProtKB/Swiss-Prot Function]