NT5C1A (NM_032526) Human Recombinant Protein

CAT#: TP324617

Purified recombinant protein of Homo sapiens 5'-nucleotidase, cytosolic IA (NT5C1A)

Product Images

Coomassie blue staining of purified NT5C1A protein (Cat# TP324617). The protein was produced from HEK293T cells transfected with NT5C1A cDNA clone (Cat# RC224617) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224617 representing NM_032526
  Red=Cloning site Green=Tags(s)
  
  MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQI
  YTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINS
  INHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVVVSQSQLRVAF
  DGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLV
  TARSAASSGARALKTLRSWGLETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG
  VAQTPRRTAPAKQAPSAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115915
• Locus ID: 84618
• UniProt ID: Q9BXI3
• Cytogenetics: 1p34.2
• Refseq Size: 1107
• Refseq ORF: 1104
• Synonyms: CN-I; CN-IA; CN1; CN1A; CNI
• Summary: Cytosolic nucleotidases, such as NT5C1A, dephosphorylate nucleoside monophosphates (Hunsucker et al., 2001 [PubMed 11133996]).[supplied by OMIM, Mar 2008]
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism