CSRP3 (NM_001127656) Human Recombinant Protein

CAT#: TP325217

Recombinant protein of human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2

Product Images

CSRP3 is the substrate of O-glycosidase, according to Western blot (WB) and Amaranthus caudatus lectin blot (LB) analyses of recombinant human CSRP3. Recombinant proteins expressed in E. coli (unglycosylated negative control) and HEK293 cells (potentially glycosylated reference) (OriGene TP325217) were analyzed after treatment with sialidase and O-glycosidase. Figure cited from PLoS ONE, PMID: 27281159

• 

  CSRP3 binds to Amaranthus caudatus lectin (ACA), according to Western blot (WB) and ACA lectin blot (LB) analyses of recombinant human CSRP3. Recombinant proteins expressed in E. coli (unglycosylated negative control) and HEK293 cells (potentially glycosylated reference) (OriGene TP325217) were analyzed after treatment with sialidase and O-glycosidase. Figure cited from PLoS ONE, PMID: 27281159

• 

  Altered O-glycosylation on CSRP3 in the left ventricle of Dahl salt-sensitive rats, according to Western blot (WB) and Amaranthus caudatus lectin blot (LB) analyses of CSRP3 from the left ventricle extracts of Dahl salt-sensitive rats under a low-salt (LS) or high-salt (HS) diet for 12 or 16 weeks. CSRP3 in the extracts was immunoprecipitated, denatured, separated by SDS-PAGE, and analyzed. Recombinant human CSRP3 (OriGene TP325217) served as a control for immunoprecipitation with the anti-CSRP3 antibody (+) or normal IgG (-). Figure cited from PLoS ONE, PMID: 27281159

• 

  Coomassie blue staining of purified CSRP3 protein (Cat# TP325217). The protein was produced from HEK293T cells transfected with CSRP3 cDNA clone (Cat# RC225217) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225217 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG
  IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW
  HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme substrate (PMID: 27281159)
  Binding assay (PMID: 27281159)
  Co-immunoprecipitation (PMID: 27281159)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001121128
• Locus ID: 8048
• UniProt ID: P50461
• Cytogenetics: 11p15.1
• Refseq Size: 1464
• Refseq ORF: 582
• Synonyms: CLP; CMD1M; CMH12; CRP3; LMO4; MLP
• Summary: This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]