CNTF (NM_000614) Human Recombinant Protein
CAT#: TP720608
Purified recombinant protein of Human ciliary neurotrophic factor (CNTF)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
|
Tag | Tag Free |
Predicted MW | 22.93 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000605 |
Locus ID | 1270 |
UniProt ID | P26441 |
Cytogenetics | 11q12.1 |
Refseq Size | 1891 |
Refseq ORF | 600 |
Synonyms | HCNTF |
Summary | The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424606 | CNTF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424606 | Transient overexpression lysate of ciliary neurotrophic factor (CNTF) |
USD 325.00 |
|
PH322331 | CNTF MS Standard C13 and N15-labeled recombinant protein (NP_000605) |
USD 2,055.00 |
|
TP322331 | Recombinant protein of human ciliary neurotrophic factor (CNTF) |
USD 748.00 |
|
TP723056 | Purified recombinant protein of Human ciliary neurotrophic factor (CNTF). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review