CNTF (NM_000614) Human Recombinant Protein

CAT#: TP723056

Purified recombinant protein of Human ciliary neurotrophic factor (CNTF).


  View other "CNTF" proteins (5)

USD 240.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "CNTF"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTQSYVKHQGLNKNINLDSADGMPVASTDQWSQLTQAQRLQQNLQAYRTFHVLLARLLQDQQVHFTPTQGDFHQAIHTLLLQVAAFAYQIQQLMILLQYKIPRNQADGMPINVGDGGLFQKKLWGLKVLQQLSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Tag Tag Free
Predicted MW 22.8 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to stimulate proliferation of human TF-1 cells using an ED50 concentration range of 50-150 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000605
Locus ID 1270
UniProt ID P26441
Cytogenetics 11q12.1
Refseq Size 1891
Refseq ORF 600
Synonyms HCNTF
Summary The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]
Protein Families Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.