Vinculin (VCL) (NM_003373) Human Recombinant Protein
CAT#: TP720619
Purified recombinant protein of Human vinculin (VCL), transcript variant 2
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTLEKMSAEINEIIRVLQLTSWDE
|
Tag | Tag Free |
Predicted MW | 117 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003364 |
Locus ID | 7414 |
UniProt ID | P18206, A0A024QZN4, B3KXA2 |
Cytogenetics | 10q22.2 |
Refseq Size | 5443 |
Refseq ORF | 3198 |
Synonyms | CMD1W; CMH15; HEL114; MV; MVCL |
Summary | 'Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418728 | VCL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418728 | Transient overexpression lysate of vinculin (VCL), transcript variant 2 |
USD 325.00 |
|
PH304576 | VCL MS Standard C13 and N15-labeled recombinant protein (NP_003364) |
USD 2,055.00 |
|
TP304576 | Recombinant protein of human vinculin (VCL), transcript variant 2 |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review