NFYA (NM_021705) Human Recombinant Protein
CAT#: TP720850
Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMEQYTANSNSSTEQIVVQAGQIQQQV
|
Tag | N-GST |
Predicted MW | 60.58 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_068351 |
Locus ID | 4800 |
UniProt ID | P23511, A0A024RD22 |
Cytogenetics | 6p21.1 |
Refseq Size | 6149 |
Refseq ORF | 954 |
Synonyms | CBF-A; CBF-B; HAP2; NF-YA |
Summary | 'The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. [provided by RefSeq, Jul 2008]' |
Protein Families | Transcription Factors |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400893 | NFYA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC411938 | NFYA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400893 | Transient overexpression lysate of nuclear transcription factor Y, alpha (NFYA), transcript variant 1 |
USD 325.00 |
|
LY411938 | Transient overexpression lysate of nuclear transcription factor Y, alpha (NFYA), transcript variant 2 |
USD 325.00 |
|
TP721153 | Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2 |
USD 300.00 |
|
TP760255 | Recombinant protein of human nuclear transcription factor Y, alpha (NFYA), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP761138 | Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review