Tnf (NM_013693) Mouse Recombinant Protein
CAT#: TP720872
Purified recombinant protein of Mouse tumor necrosis factor (Tnf)
Product Images
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
|
Tag | Tag Free |
Predicted MW | 16.4 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_038721 |
Locus ID | 21926 |
UniProt ID | P06804, Q3U593 |
Cytogenetics | 17 18.59 cM |
Refseq Size | 1619 |
Refseq ORF | 705 |
Synonyms | DIF; TNF-a; TNF-alpha; Tnfa; TNFalpha; Tnfsf1a; TNFSF2; Tnlg1f |
Summary | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP512145 | Purified recombinant protein of Mouse tumor necrosis factor (Tnf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP723452 | Purified recombinant protein of Mouse tumor necrosis factor (Tnf). |
USD 240.00 |
|
TP723453 | Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf). |
USD 240.00 |
|
TP723743 | Purified recombinant protein of Mouse tumor necrosis factor (Tnf) |
USD 205.00 |
|
TP723777 | Purified recombinant protein of Rat tumor necrosis factor (TNF superfamily, member 2) (Tnf), (10 ug) |
USD 230.00 |
{0} Product Review(s)
Be the first one to submit a review